Hilalkargo.com valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
Meta Tags
| Title | Adana HİLAL KARGO EVDEN EVE TAŞIMACILIK,adana evden eve nakliyat firmaları, adana evden eve nakliyat şirketleri, adana evden eve taşımacılık firmaları, adana evden eve taşımacılık şirketleri |
| Description | |
| Keywords | N/A |
Server Information
| WebSite | |
| Host IP | 178.210.169.21 |
| Location | Turkey |
Related Websites
| Site | Rank |
| adanaevdenevenakliyati.net | #5,392,196 |
| seyhankargo.com | #3,643,055 |
| adanaevdenevenakliyatfirmalari.com | #5,214,590 |
| adanatrans.com | #3,181,733 |
| ekonomiktasimacilik.com | #4,729,397 |
More to Explore
| hindugeek.com |
| hobim.com |
| hocgioichoigioi.com |
| hochland.pl |
| home-assistant.cc |
| homegarden-shop.ru |
| hookoff.ru |
| hotelariya.ir |
| hotmarathistories.com |
| hotsgram.com |
| beyondfurnishing.co.kr |
| bluff.kr |
Hilalkargo.com Valuation
|
US$7,111
Last updated: Jan 5, 2020
Hilalkargo.com has global traffic rank of 4,762,848. Hilalkargo.com has an estimated worth of US$ 7,111, based on its estimated Ads revenue. Hilalkargo.com receives approximately 649 unique visitors each day. Its web server is located in Turkey, with IP address 178.210.169.21. According to SiteAdvisor, hilalkargo.com is safe to visit. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$7,111 |
| Daily Ads Revenue | US$3 |
| Monthly Ads Revenue | US$116 |
| Yearly Ads Revenue | US$1,422 |
| Daily Unique Visitors | 649 |
| Note: All traffic and earnings values are estimates. | |
Traffic Ranks
| Global Rank | 4,762,848 |
| Delta (90 Days) | 0 |
| Most Popular In Country | N/A |
| Country Rank | N/A |
DNS Records
| Host | Type | TTL | Data |
| hilalkargo.com | A | 3599 | IP: 178.210.169.21 |
| hilalkargo.com | MX | 3599 | Priority: 10 Target: smtp.hilalkargo.com. |
| hilalkargo.com | NS | 3599 | Target: ns3.selebrummedya.com. |
| hilalkargo.com | NS | 3599 | Target: ns4.selebrummedya.com. |
| hilalkargo.com | TXT | 3599 | TXT: v=spf1 mx a ptr ip4:178.210.168.149/32 ip4:178.210.168.150/32 -all |
| hilalkargo.com | SOA | 3599 | MNAME: ns3.selebrummedya.com. RNAME: hostmaster.hilalkargo.com. Serial: 1608101348 Refresh: 36000 Retry: 600 Expire: 86400 Minimum TTL: 3600 |
HTTP Headers
HTTP/1.1 200 OK Cache-Control: private Content-Type: text/html; charset=utf-8 Server: Microsoft-IIS/8.5 X-AspNet-Version: 4.0.30319 Set-Cookie: ASP.NET_SessionId=vpb5dfmw20zhuej5gyt2qhuq; path=/; HttpOnly; SameSite=Lax Date: Sun, 05 Jan 2020 05:20:49 GMT Content-Length: 49649 |
Hilalkargo.com Whois Information
Domain Name: HILALKARGO.COM Registry Domain ID: 2047375629_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.isimtescil.net Registrar URL: http://www.isimtescil.net Updated Date: 2019-07-31T19:38:58Z Creation Date: 2016-07-29T12:42:59Z Registry Expiry Date: 2020-07-29T12:42:59Z Registrar: FBS Inc. Registrar IANA ID: 1110 Registrar Abuse Contact Email: abuse@domaintime.biz Registrar Abuse Contact Phone: +90.8502000444 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: NS3.SELEBRUMMEDYA.COM.TR Name Server: NS4.SELEBRUMMEDYA.COM.TR DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ |